NKG2D/CD314, Mouse (HEK293, His)

Name: NKG2D/CD314, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0204638-01
Price: 72.61 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0204638-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The NKG2D/CD314 protein activates and stimulates the innate immune response of NK cells by binding to stress-inducing ligands on tumor and virus-infected cells.It also acts as a costimulatory receptor for TCR, enhancing T cell activation and eliminating tumor cells.NKG2D/CD314 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag.
Molecular Formula
27007 (Gene_ID) O54709 (F94-V232) (Accession)
Smiles
FQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204638-01	5 µgQM-0204638-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0204638-02	10 µgQM-0204638-02 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0204638-03	50 µgQM-0204638-03 £282.06/ea	£0.00	Quantity	£282.06/ea	£0.00

100 µgQM-0204638-04	100 µgQM-0204638-04 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

500 µgQM-0204638-05	500 µgQM-0204638-05 £1,156.87/ea	£0.00	Quantity	£1,156.87/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

NKG2D/CD314, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.