1 1

NKp30/NCR3, Cynomolgus/Rhesus Macaque (HEK293, His)

NKp30/NCR3, Cynomolgus/Rhesus Macaque (HEK293, His)

Size

QM-0203285-01

£69.50 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    NKp30/NCR3 protein is a cell membrane receptor on natural killer (NK) cells that activates cytotoxicity by binding to ligands such as BAG6 and NCR3LG1, stimulating NK cells to respond against neighboring cells (including tumor cells) expressing these ligands. NKp30/NCR3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived NKp30/NCR3 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    102133932 (Gene_ID) XP_005553604 (L19-G135) (Accession)

  • Smiles

    LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLG

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0203285-01
5 µgQM-0203285-01
£69.50/ea		 £0.00
£69.50/ea £0.00
10 µgQM-0203285-02
10 µgQM-0203285-02
£107.13/ea		 £0.00
£107.13/ea £0.00
50 µgQM-0203285-03
50 µgQM-0203285-03
£305.15/ea		 £0.00
£305.15/ea £0.00
100 µgQM-0203285-04
100 µgQM-0203285-04
£481.32/ea		 £0.00
£481.32/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

NKp30/NCR3, Cynomolgus/Rhesus Macaque (HEK293, His)

NKp30/NCR3, Cynomolgus/Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.