NKp30/NCR3, Human (HEK293, His)

Name: NKp30/NCR3, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0185035-01
Price: 137.5 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0185035-01

£137.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
NKp30/NCR3 protein is a cell membrane receptor on NK cells and is activated by binding to ligands such as BAG6 and NCR3LG1. This activation enhances NK cell cytotoxicity against neighboring cells that produce these ligands, including tumor cells. NKp30/NCR3 Protein, Human (HEK293, His) is the recombinant human-derived NKp30/NCR3 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
259197 (Gene_ID) O14931-1 (L19-T138) (Accession)
Smiles
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGT
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0185035-01	10 µgQM-0185035-01 £137.50/ea	£0.00	Quantity	£137.50/ea	£0.00

50 µgQM-0185035-02	50 µgQM-0185035-02 £392.63/ea	£0.00	Quantity	£392.63/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

NKp30/NCR3, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.