NKp44/NCR2, Human (HEK293, His)

Name: NKp44/NCR2, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0200882-01
Price: 72.61 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0200882-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The NKp44/NCR2 protein is a cytotoxicity-activating receptor on natural killer (NK) cells that may increase their tumor cell lysis efficiency. NKp44/NCR2 interacts with TYROBP/DAP12, an important signal transduction adapter, and is critical for transducing signals that activate NK cells against target cells. NKp44/NCR2 Protein, Human (HEK293, His) is the recombinant human-derived NKp44/NCR2 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
9436 (Gene_ID) O95944/NP_004819.2 (Q22-P190) (Accession)
Smiles
QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP
Purity
98.97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0200882-01	5 µgQM-0200882-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0200882-02	10 µgQM-0200882-02 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0200882-03	50 µgQM-0200882-03 £282.06/ea	£0.00	Quantity	£282.06/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

NKp44/NCR2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.