Skip to product information
1 of 1

NKp46/NCR1, Human (HEK293, Fc)

NKp46/NCR1, Human (HEK293, Fc)

Size

SKU:QM-0171117-01

£143.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    NKp46/NCR1 Protein is a major NK cell-activating receptor that is involved in the elimination of target cells and recognizing a wide range of tumors, viruses, and bacteria. NKp46 forms microclusters structures at the immune synapse between NK cells and target cells. Over-expression of human NKp46 is correlated with increased accumulation of F-actin mesh at the immune synapse. NKp46 signaling directly regulates the NK lytic immune synapse from early formation to late function[1][2][3]. NKp46/NCR1 Protein, Human (HEK293, Fc) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    9437 (Gene_ID) AAH64806 (Q22-N254) (Accession)

  • Smiles

    QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQN

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0171117-01
10 µgQM-0171117-01
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0171117-02
50 µgQM-0171117-02
£431.51/ea
£0.00
£431.51/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

NKp46/NCR1, Human (HEK293, Fc)

NKp46/NCR1, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.