Skip to product information
1 of 1

NKp80/KLRF1, Cynomolgus (HEK293, Fc)

NKp80/KLRF1, Cynomolgus (HEK293, Fc)

Size

SKU:QM-0199550-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    NKp80/KLRF1 Protein plays a pivotal role in the natural killer (NK) -mediated cytolysis of PHA-induced lymphoblasts, highlighting its significance in immune response. As a homodimer, it structurally arranges in cells. Its involvement in NK-mediated cytolysis contributes to the immune system's ability to eliminate specific cell populations, enhancing cellular defense mechanisms. NKp80/KLRF1 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived NKp80/KLRF1 protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    102141941 (Gene_ID) Q8MI05 (V66-Y231) (Accession)

  • Smiles

    VLLKCQKGSHSNTTEHEDIGDLKMNNGTRRNTSNKDLCVSRSADQTVLCQSEWLKYRGKCYWFSNEMKSWSDSYVYCLERKSHLLIIQDELEMAFIQKNLRQSNYVWMGLNFTSLKMTWTWVDGSPLDPKIFFIKGPAKENSCAAIKESKIYSETCSSVFKWICQY

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0199550-01
5 µgQM-0199550-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0199550-02
10 µgQM-0199550-02
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0199550-03
50 µgQM-0199550-03
£243.19/ea
£0.00
£243.19/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

NKp80/KLRF1, Cynomolgus (HEK293, Fc)

NKp80/KLRF1, Cynomolgus (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.