Skip to product information
1 of 1

NME1/NDPKA, Human (His)

NME1/NDPKA, Human (His)

Size

SKU:QM-0173572-01

£241.46 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The NME1/NDPKA protein plays a crucial role in the synthesis of nucleoside triphosphates and exhibits multiple activities, including nucleoside diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease functions. NME1/NDPKA Protein, Human (His) is the recombinant human-derived NME1/NDPKA protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    4830 (Gene_ID) P15531-1 (M1-E152) (Accession)

  • Smiles

    MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0173572-01
10 µgQM-0173572-01
£241.46/ea
£0.00
£241.46/ea £0.00
50 µgQM-0173572-02
50 µgQM-0173572-02
£540.35/ea
£0.00
£540.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

NME1/NDPKA, Human (His)

NME1/NDPKA, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.