NODAL, Human

Nodal protein plays a key role in embryonic development and is indispensable for mesoderm formation and axial patterning. As a homodimer linked together by disulfide bonds, Nodal helps form the molecular framework that controls fundamental developmental pathways, ensuring the correct establishment of mesodermal tissue and axial structure during embryogenesis. NODAL Protein, Human is the recombinant human-derived NODAL protein, expressed by E. coli, with tag free.

4838 (Gene_ID) Q96S42 (H238-L347) (Accession)

HLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL

90

Stored at -20°C for 2 years

Room temperature in continental US; may vary elsewhere.