Name: Noggin, Human (HEK293)
Brand: QuantiMol
SKU: QM-0204014-01
Price: 74.68 GBP
Availability: InStock

Product Details

Description
Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin is a potent bone morphogenetic protein (BMP) antagonist. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency. Noggin Protein, Human (HEK293) is a recombinant Noggin protein produced by HEK293 cells.
Molecular Formula
9241 (Gene_ID) Q13253 (Q28-C232) (Accession)
Smiles
QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204014-01	5 µgQM-0204014-01 £74.68/ea	£0.00	Quantity	£74.68/ea	£0.00

10 µgQM-0204014-02	10 µgQM-0204014-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0204014-03	50 µgQM-0204014-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0204014-04	100 µgQM-0204014-04 £476.46/ea	£0.00	Quantity	£476.46/ea	£0.00

250 µgQM-0204014-05	250 µgQM-0204014-05 £996.49/ea	£0.00	Quantity	£996.49/ea	£0.00

500 µgQM-0204014-06	500 µgQM-0204014-06 £1,661.09/ea	£0.00	Quantity	£1,661.09/ea	£0.00

1 mgQM-0204014-07	1 mgQM-0204014-07 £2,263.73/ea	£0.00	Quantity	£2,263.73/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Noggin, Human (HEK293)

Noggin, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.