Skip to product information
1 of 1

Noggin, Mouse (HEK293)

Noggin, Mouse (HEK293)

Size

SKU:QM-0077570-01

£65.37 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites.By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6.Noggin Protein, Mouse (HEK293) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with tag free.

  • Molecular Formula

    18121 (Gene_ID) P97466 (Q28-C232) (Accession)

  • Smiles

    QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0077570-01
5 µgQM-0077570-01
£65.37/ea
£0.00
£65.37/ea £0.00
10 µgQM-0077570-02
10 µgQM-0077570-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0077570-03
50 µgQM-0077570-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0077570-04
100 µgQM-0077570-04
£404.78/ea
£0.00
£404.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Noggin, Mouse (HEK293)

Noggin, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.