Skip to product information
1 of 1

Notum, Human (C330S, CHO, His)

Notum, Human (C330S, CHO, His)

Size

SKU:QM-0204231-01

£147.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Notum Protein serves as a crucial negative regulator of the Wnt signaling pathway, playing a specific role in mediating the depalmitoleoylation of WNT proteins. The process of serine palmitoleoylation of WNT proteins is essential for their efficient binding to frizzled receptors, and Notum's carboxylesterase activity is instrumental in modulating this aspect of the Wnt signaling cascade. Notum Protein, Human (C330S, CHO, His) is the recombinant human-derived Notum protein, expressed by CHO , with C-His labeled tag.

  • Molecular Formula

    147111 (Gene_ID) Q6P988 (S81-T451, C330S) (Accession)

  • Smiles

    SAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRSPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPT

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204231-01
5 µgQM-0204231-01
£147.63/ea
£0.00
£147.63/ea £0.00
10 µgQM-0204231-02
10 µgQM-0204231-02
£260.19/ea
£0.00
£260.19/ea £0.00
50 µgQM-0204231-03
50 µgQM-0204231-03
£604.04/ea
£0.00
£604.04/ea £0.00
100 µgQM-0204231-04
100 µgQM-0204231-04
£935.74/ea
£0.00
£935.74/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Notum, Human (C330S, CHO, His)

Notum, Human (C330S, CHO, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.