Skip to product information
1 of 1

NPPB, Human (His)

NPPB, Human (His)

Size

SKU:QM-0202254-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (His) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    4879 (Gene_ID) P16860 (H27-H134) (Accession)

  • Smiles

    HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202254-01
5 µgQM-0202254-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0202254-02
10 µgQM-0202254-02
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0202254-03
50 µgQM-0202254-03
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

NPPB, Human (His)

NPPB, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.