Skip to product information
1 of 1

NPPB, Human (His, solution)

NPPB, Human (His, solution)

Size

SKU:QM-0169794-01

£152.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (His, solution) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    4879 (Gene_ID) P16860 (H27-H134) (Accession)

  • Smiles

    HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0169794-01
10 µgQM-0169794-01
£152.38/ea
£0.00
£152.38/ea £0.00
50 µgQM-0169794-02
50 µgQM-0169794-02
£406.69/ea
£0.00
£406.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

NPPB, Human (His, solution)

NPPB, Human (His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.