1 1

NR3C1, Human (His)

NR3C1, Human (His)

Size

QM-0108577

Price on request

Request quote or documents

View full details

Product Details

  • Description

    NR3C1 Protein, Human (His, GST) is the recombinant human-derived NR3C1, expressed by E. coli , with N-10*His, N-GST labeled tag.

  • Molecular Formula

    2908 (Gene_ID) P04150-1 (V521-K777) (Accession)

  • Smiles

    VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

  • Purity

    91

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0108577
1 EachQM-0108577
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

NR3C1, Human (His)

NR3C1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.