Skip to product information
1 of 1

NRAS, Human (His, solution)

NRAS, Human (His, solution)

Size

SKU:QM-0203579-01

£122.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (His, solution) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    4893 (Gene_ID) P01111 (M1-C186) (Accession)

  • Smiles

    MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC

  • Purity

    95.2

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203579-01
2 µgQM-0203579-01
£122.00/ea
£0.00
£122.00/ea £0.00
10 µgQM-0203579-02
10 µgQM-0203579-02
£296.13/ea
£0.00
£296.13/ea £0.00
20 µgQM-0203579-03
20 µgQM-0203579-03
£406.69/ea
£0.00
£406.69/ea £0.00
50 µgQM-0203579-04
50 µgQM-0203579-04
£739.61/ea
£0.00
£739.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

NRAS, Human (His, solution)

NRAS, Human (His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.