NRG1-beta 2, Human

Name: NRG1-beta 2, Human
Brand: QuantiMol
SKU: QM-0205077-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0205077-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 2 Protein, Human is the recombinant human-derived NRG1-beta 2 protein, expressed by E. coli , with tag free.
Molecular Formula
3084 (Gene_ID) Q02297-7 (S177-Q237) /E5RIG8 (S23-Q83) (Accession)
Smiles
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205077-01	2 µgQM-0205077-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205077-02	10 µgQM-0205077-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0205077-03	50 µgQM-0205077-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0205077-04	100 µgQM-0205077-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

500 µgQM-0205077-05	500 µgQM-0205077-05 £1,100.97/ea	£0.00	Quantity	£1,100.97/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

NRG1-beta 2, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.