NT-4, Mouse

Name: NT-4, Mouse
Brand: QuantiMol
SKU: QM-0185656-01
Price: 260.19 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0185656-01

£260.19 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
NT-4 Protein, Mouse is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR) .
Molecular Formula
78405 (Gene_ID) Q80VU4 (G80-A209) (Accession)
Smiles
MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0185656-01	10 µgQM-0185656-01 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

50 µgQM-0185656-02	50 µgQM-0185656-02 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

NT-4, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.