Name: NT5C3A/NT5C3, Human
Brand: QuantiMol
SKU: QM-0075809-01
Price: 59.16 GBP
Availability: InStock

Product Details

Description
NT5C3A/NT5C3 Protein, a nucleotidase, preferentially hydrolyzes cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m (7) GMP), emphasizing a potential role in cellular processes, with a preference for CMP. NT5C3A/NT5C3 Protein, Human is the recombinant human-derived NT5C3A/NT5C3 protein, expressed by E. coli , with tag free.
Molecular Formula
51251 (Gene_ID) Q9H0P0-1 (M12-L297) (Accession)
Smiles
MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Purity
99
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0075809-01	5 µgQM-0075809-01 £59.16/ea	£0.00	Quantity	£59.16/ea	£0.00

10 µgQM-0075809-02	10 µgQM-0075809-02 £79.85/ea	£0.00	Quantity	£79.85/ea	£0.00

50 µgQM-0075809-03	50 µgQM-0075809-03 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

100 µgQM-0075809-04	100 µgQM-0075809-04 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

500 µgQM-0075809-05	500 µgQM-0075809-05 £847.04/ea	£0.00	Quantity	£847.04/ea	£0.00

1 mgQM-0075809-06	1 mgQM-0075809-06 £1,323.32/ea	£0.00	Quantity	£1,323.32/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

NT5C3A/NT5C3, Human

NT5C3A/NT5C3, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.