Skip to product information
1 of 1

NucA, S. marcescens

NucA, S. marcescens

Size

SKU:QM-0201981-01

£124.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The NucA protein plays a central role in cellular processes because it catalyzes the hydrolysis of DNA and RNA (both double- and single-stranded) at the 3' position of the phosphodiester bond to generate 5'-phosphorylated single- and double-stranded , tri- and tetra-nucleotides. This multifunctional enzymatic activity emphasizes the importance of NucA in nucleic acid metabolism, as observed in various studies. NucA Protein, S. marcescens is the recombinant NucA protein, expressed by E. coli , with tag free.

  • Molecular Formula

    87005285 (Gene_ID) P13717 (M1-N266) (Accession)

  • Smiles

    MRFNNKMLALAALLFAAQASADTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0201981-01
5 µgQM-0201981-01
£124.25/ea
£0.00
£124.25/ea £0.00
10 µgQM-0201981-02
10 µgQM-0201981-02
£168.13/ea
£0.00
£168.13/ea £0.00
50 µgQM-0201981-03
50 µgQM-0201981-03
£406.69/ea
£0.00
£406.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

NucA, S. marcescens

NucA, S. marcescens is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.