Skip to product information
1 of 1

Nucleobindin-2, Human

Nucleobindin-2, Human

Size

SKU:QM-0193082-01

£238.32 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Nucleobindin-2 protein is a calcium-binding molecule that may contribute to calcium homeostasis and act as a non-receptor guanine nucleotide exchange factor. Its interaction with the guanine nucleotide-binding protein (G protein) α subunit GNAI3 suggests its role in activating the G protein signaling pathway. Nucleobindin-2 Protein, Human is the recombinant human-derived Nucleobindin-2 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    4925 (Gene_ID) P80303-1 (V25-L106) (Accession)

  • Smiles

    VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0193082-01
10 µgQM-0193082-01
£238.32/ea
£0.00
£238.32/ea £0.00
50 µgQM-0193082-02
50 µgQM-0193082-02
£614.98/ea
£0.00
£614.98/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Nucleobindin-2, Human

Nucleobindin-2, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.