Skip to product information
1 of 1

Nucleoside phosphorylase/PNP, Human (His)

Nucleoside phosphorylase/PNP, Human (His)

Size

SKU:QM-0201866-01

£199.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Nucleoside phosphorylase/PNP proteins play a vital role in cellular processes by catalyzing the phosphate breakdown of β- (deoxy) ribonucleosides, preferably 6-oxopurine nucleosides, such as inosine and guanosine. This enzymatic activity results in the formation of free purine bases and pentose 1-phosphate, highlighting the importance of this protein in regulating nucleoside degradation. Nucleoside phosphorylase/PNP Protein, Human (His) is the recombinant human-derived Nucleoside phosphorylase/PNP protein, expressed by E. coli , with C-10*His labeled tag.

  • Molecular Formula

    4860 (Gene_ID) P00491 (M1-S289) (Accession)

  • Smiles

    MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0201866-01
5 µgQM-0201866-01
£199.44/ea
£0.00
£199.44/ea £0.00
10 µgQM-0201866-02
10 µgQM-0201866-02
£306.37/ea
£0.00
£306.37/ea £0.00
50 µgQM-0201866-03
50 µgQM-0201866-03
£769.28/ea
£0.00
£769.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Nucleoside phosphorylase/PNP, Human (His)

Nucleoside phosphorylase/PNP, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.