Skip to product information
1 of 1

Olfactory Marker/OMP, Human (His)

Olfactory Marker/OMP, Human (His)

Size

SKU:QM-0203772-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    OMP Protein acts as a modulator in the olfactory signal-transduction cascade, finely tuning olfactory signaling processes. Interacting with BEX1 and BEX2, OMP suggests potential associations with proteins in cellular processes, emphasizing its multifaceted role in the intricate olfactory signal transduction network and implying broader involvement in the molecular framework of olfactory function. Olfactory Marker Protein/OMP Protein, Human (His) is the recombinant human-derived Olfactory Marker protein/OMP protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    4975 (Gene_ID) P47874 (M1-L163) (Accession)

  • Smiles

    MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL

  • Purity

    94.79

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203772-01
5 µgQM-0203772-01
£101.50/ea
£0.00
£101.50/ea £0.00
10 µgQM-0203772-02
10 µgQM-0203772-02
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0203772-03
50 µgQM-0203772-03
£442.44/ea
£0.00
£442.44/ea £0.00
100 µgQM-0203772-04
100 µgQM-0203772-04
£714.61/ea
£0.00
£714.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Olfactory Marker/OMP, Human (His)

Olfactory Marker/OMP, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.