Oncomodulin-1, Human (His)

Name: Oncomodulin-1, Human (His)
Brand: QuantiMol
SKU: QM-0172020-01
Price: 238.32 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0172020-01

£238.32 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Oncomodulin-1 protein, exhibiting calmodulin-like activity, activates enzymes and regulates growth, binding two calcium ions and participating in calcium-mediated cellular processes. Oncomodulin-1 Protein, Human (His) is the recombinant human-derived Oncomodulin-1 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
654231 (Gene_ID) P0CE72 (M1-S109) (Accession)
Smiles
MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0172020-01	10 µgQM-0172020-01 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

50 µgQM-0172020-02	50 µgQM-0172020-02 £614.98/ea	£0.00	Quantity	£614.98/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Oncomodulin-1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.