OSM, Human (209a.a)

Name: OSM, Human (209a.a)
Brand: QuantiMol
SKU: QM-0193841-01
Price: 101.5 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0193841-01

£101.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
OSM Protein, Human (209a.a) is a polypeptide chain containing 209 amino acids. Oncostatin M is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism.
Molecular Formula
5008 (Gene_ID) P13725 (A26-R234) (Accession)
Smiles
MAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0193841-01	2 µgQM-0193841-01 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

10 µgQM-0193841-02	10 µgQM-0193841-02 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

50 µgQM-0193841-03	50 µgQM-0193841-03 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

100 µgQM-0193841-04	100 µgQM-0193841-04 £1,079.11/ea	£0.00	Quantity	£1,079.11/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

OSM, Human (209a.a) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.