Skip to product information
1 of 1

OSM, Human (His)

OSM, Human (His)

Size

SKU:QM-0200826-01

£77.78 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    5008 (Gene_ID) P13725 (A26-R221) (Accession)

  • Smiles

    AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0200826-01
2 µgQM-0200826-01
£77.78/ea
£0.00
£77.78/ea £0.00
10 µgQM-0200826-02
10 µgQM-0200826-02
£205.52/ea
£0.00
£205.52/ea £0.00
50 µgQM-0200826-03
50 µgQM-0200826-03
£437.58/ea
£0.00
£437.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

OSM, Human (His)

OSM, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.