OSM, Mouse

Name: OSM, Mouse
Brand: QuantiMol
SKU: QM-0195355-01
Price: 143.13 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0195355-01

£143.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
OSM Protein, Mouse is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.
Molecular Formula
18413 (Gene_ID) P53347 (N25-R205) (Accession)
Smiles
MNRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0195355-01	10 µgQM-0195355-01 £143.13/ea	£0.00	Quantity	£143.13/ea	£0.00

50 µgQM-0195355-02	50 µgQM-0195355-02 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

100 µgQM-0195355-03	100 µgQM-0195355-03 £714.61/ea	£0.00	Quantity	£714.61/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

OSM, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.