OSM, Mouse (HEK293)

Name: OSM, Mouse (HEK293)
Brand: QuantiMol
SKU: QM-0202389-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202389-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
OSM Protein, Mouse (HEK293) is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.
Molecular Formula
18413 (Gene_ID) P53347 (A24-R206) (Accession)
Smiles
ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202389-01	2 µgQM-0202389-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0202389-02	10 µgQM-0202389-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0202389-03	50 µgQM-0202389-03 £282.06/ea	£0.00	Quantity	£282.06/ea	£0.00

100 µgQM-0202389-04	100 µgQM-0202389-04 £448.52/ea	£0.00	Quantity	£448.52/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

OSM, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.