Otoraplin/OTOR, Human (CHO)

Name: Otoraplin/OTOR, Human (CHO)
Brand: QuantiMol
SKU: QM-0204859-01
Price: 61.22 GBP
Availability: InStock

Size 2 µg 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204859-01

£61.22 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Otoraplin/OTOR Protein, Human (CHO) is a protein encoded by OTOR gene, is homologous to the protein encoded by CDRAP/MIA, and may acts in cartilage development and maintenance.
Molecular Formula
56914 (Gene_ID) Q9NRC9 (V18-E128) (Accession)
Smiles
VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204859-01	2 µgQM-0204859-01 £61.22/ea	£0.00	Quantity	£61.22/ea	£0.00

5 µgQM-0204859-02	5 µgQM-0204859-02 £99.25/ea	£0.00	Quantity	£99.25/ea	£0.00

10 µgQM-0204859-03	10 µgQM-0204859-03 £143.13/ea	£0.00	Quantity	£143.13/ea	£0.00

50 µgQM-0204859-04	50 µgQM-0204859-04 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

100 µgQM-0204859-05	100 µgQM-0204859-05 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Otoraplin/OTOR, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.