Skip to product information
1 of 1

OX40/TNFRSF4, Cynomolgus/Rhesus Macaque (HEK293, His)

OX40/TNFRSF4, Cynomolgus/Rhesus Macaque (HEK293, His)

Size

SKU:QM-0179190-01

£94.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40/TNFRSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is a recombinant rhesus macaque OX40 with C-terminal His tag, which is produced in HEK293.

  • Molecular Formula

    102145978/699674 (Gene_ID) XP_001090870.1/XP_001090870.1 (K28-A216) (Accession)

  • Smiles

    KLHCVGDTYPSNDRCCQECRPGNGMVSRCNRSQNTVCRPCGPGFYNDVVSAKPCKACTWCNLRSGSERKQPCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPPTQPQETQGPPARPTTVQPTEAWPRTSQRPSTRPVEVPRGPAVA

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0179190-01
10 µgQM-0179190-01
£94.75/ea
£0.00
£94.75/ea £0.00
50 µgQM-0179190-02
50 µgQM-0179190-02
£260.19/ea
£0.00
£260.19/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

OX40/TNFRSF4, Cynomolgus/Rhesus Macaque (HEK293, His)

OX40/TNFRSF4, Cynomolgus/Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.