1 1

P2ER3, Human (His)

P2ER3, Human (His)

Size

QM-0027537

Price on request

Request quote or documents

View full details

Product Details

  • Description

    P2ER3 Protein, Human (His) is the recombinant human-derived P2ER3, expressed by E.coli , with His abeled tag.

  • Molecular Formula

    5733 (Gene_ID) P43115 (M1-A53) (Accession)

  • Smiles

    MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0027537
1 EachQM-0027537
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

P2ER3, Human (His)

P2ER3, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.