1 1

PAEP, Human (HEK293, His)

PAEP, Human (HEK293, His)

Size

QM-0084398

£936.43 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    PAEP protein is a glycoprotein that regulates fertilization steps and exhibits immunomodulatory effects. PAEP Protein, Human (HEK293, His) is the recombinant human-derived PAEP protein, expressed by HEK293 , with N-10*His labeled tag.

  • Molecular Formula

    5047 (Gene_ID) P09466-1 (M19-F180) (Accession)

  • Smiles

    MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice
Learn more
Variant Variant total Quantity Price Variant total
50 µgQM-0084398
50 µgQM-0084398
£936.43/ea		 £0.00
£936.43/ea £0.00

Related Products

Other industry favorites

PAEP, Human (HEK293, His)

PAEP, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.