PANP/C12orf53, Human (HEK293, Fc)

Name: PANP/C12orf53, Human (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0203685-01
Price: 62.26 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203685-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PANP/C12orf53 Protein acts as a neural tissue ligand for PILRA, indicating its potential role in immune regulation in this context. PANP/C12orf53 Protein, Human (HEK293, Fc) is the recombinant human-derived PANP/C12orf53 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
196500 (Gene_ID) Q8IYJ0-1 (S32-P178) (Accession)
Smiles
SSSSPRTPPAPARPPCARGGPSAPRHVCVWERAPPPSRSPRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLILGEAPATLRPFLFGGRGEGVDP
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203685-01	5 µgQM-0203685-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0203685-02	10 µgQM-0203685-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0203685-03	50 µgQM-0203685-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0203685-04	100 µgQM-0203685-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PANP/C12orf53, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.