Skip to product information
1 of 1

PAP, Human (His)

PAP, Human (His)

Size

SKU:QM-0184455-01

£230.52 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PAP proteins play a dual regulatory role in cell growth, exhibiting different effects depending on the specific growth factors involved. In fibroblasts, it exerts a positive regulatory effect by enhancing PDGFA-stimulated cell growth. PAP Protein, Human (His) is the recombinant human-derived PAP protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    11333 (Gene_ID) Q13442 (M1-K181) (Accession)

  • Smiles

    MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

  • Purity

    95

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0184455-01
10 µgQM-0184455-01
£230.52/ea
£0.00
£230.52/ea £0.00
50 µgQM-0184455-02
50 µgQM-0184455-02
£517.26/ea
£0.00
£517.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PAP, Human (His)

PAP, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.