Skip to product information
1 of 1

PAX8, Human (His)

PAX8, Human (His)

Size

SKU:QM-0203436-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PAX8 protein, a crucial transcription factor, is essential for thyroid-specific gene expression, maintaining the functional differentiation of thyroid cells. It plays a pivotal role in regulating the thyroid-specific gene profile, contributing to specialized thyroid cell function. PAX8 also interacts with WWTR1, indicating a potential partnership in modulating gene expression and cellular processes in thyroid cells. PAX8 Protein, Human (His) is the recombinant human-derived PAX8 protein, expressed by E. coli , with C-His labeled tag.

  • Molecular Formula

    7849 (Gene_ID) Q06710 (P2-S146) (Accession)

  • Smiles

    PHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203436-01
5 µgQM-0203436-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0203436-02
10 µgQM-0203436-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0203436-03
50 µgQM-0203436-03
£293.00/ea
£0.00
£293.00/ea £0.00
100 µgQM-0203436-04
100 µgQM-0203436-04
£492.26/ea
£0.00
£492.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PAX8, Human (His)

PAX8, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.