Skip to product information
1 of 1

PCNA, Human (sf9, His)

PCNA, Human (sf9, His)

Size

SKU:QM-0198579-01

£97.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PCNA, an atypical member of the sulfotransferase family, displays notably low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and minimal catalytic activity towards substrates like L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. Its precise function remains elusive, but PCNA is suggested to participate in drug and neurotransmitter metabolism within the central nervous system (CNS) . PCNA Protein, Human (sf9, His) is the recombinant human-derived PCNA protein, expressed by Sf9 insect cells , with N-His labeled tag.

  • Molecular Formula

    5111 (Gene_ID) P12004 (M1-S261) (Accession)

  • Smiles

    MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

  • Purity

    91.4

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0198579-01
5 µgQM-0198579-01
£97.61/ea
£0.00
£97.61/ea £0.00
20 µgQM-0198579-02
20 µgQM-0198579-02
£172.63/ea
£0.00
£172.63/ea £0.00
50 µgQM-0198579-03
50 µgQM-0198579-03
£330.15/ea
£0.00
£330.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PCNA, Human (sf9, His)

PCNA, Human (sf9, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.