Skip to product information
1 of 1

PCSK6, Human (HEK293, hFc)

PCSK6, Human (HEK293, hFc)

Size

SKU:QM-0197035-01

£631.99 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (HEK293, hFc) is the recombinant human-derived PCSK6 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

  • Smiles

    REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

  • Purity

    94

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0197035-01
20 µgQM-0197035-01
£631.99/ea
£0.00
£631.99/ea £0.00
50 µgQM-0197035-02
50 µgQM-0197035-02
£1,156.87/ea
£0.00
£1,156.87/ea £0.00
100 µgQM-0197035-03
100 µgQM-0197035-03
£1,821.47/ea
£0.00
£1,821.47/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PCSK6, Human (HEK293, hFc)

PCSK6, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.