Skip to product information
1 of 1

PCSK6, Human (His)

PCSK6, Human (His)

Size

SKU:QM-0099836-01

£320.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PCSK6 protein is a serine endoprotease that plays a key role in preprotein processing by cleavage at sites with paired basic amino acids, specifically recognizing the RXXX[KR]R consensus motif. Its function may be involved in the constitutive secretory pathway, with a unique and limited distribution in neuroendocrine and non-neuroendocrine tissues. PCSK6 Protein, Human (His) is the recombinant human-derived PCSK6 protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    5046 (Gene_ID) P29122-1 (R860-G969) (Accession)

  • Smiles

    REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

  • Purity

    92

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0099836-01
20 µgQM-0099836-01
£320.94/ea
£0.00
£320.94/ea £0.00
50 µgQM-0099836-02
50 µgQM-0099836-02
£570.02/ea
£0.00
£570.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PCSK6, Human (His)

PCSK6, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.