PD-1, Canine (HEK293, Fc)

Name: PD-1, Canine (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0169269-01
Price: 71.58 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0169269-01

£71.58 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor which delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2, playing a critical role in induction and maintenance of immune tolerance to self. PDCD1 plays a role in anti-tumor immunity and is involved in safeguarding against autoimmunity, but PDCD1-mediated inhibitory pathway is also exploited by tumors to attenuate anti-tumor immunity. PD-1 Protein, Canine (HEK293, Fc) is the recombinant canine-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
486213 (Gene_ID) A0A8C0LHR8/NP_001301026.1 (L25-V170) (Accession)
Smiles
LDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVTRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQGLV
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0169269-01	5 µgQM-0169269-01 £71.58/ea	£0.00	Quantity	£71.58/ea	£0.00

10 µgQM-0169269-02	10 µgQM-0169269-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0169269-03	50 µgQM-0169269-03 £310.01/ea	£0.00	Quantity	£310.01/ea	£0.00

100 µgQM-0169269-04	100 µgQM-0169269-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PD-1, Canine (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.