PD-1, Mouse (HEK293, Fc)

Name: PD-1, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0205290-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0205290-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The PD-1 protein is expressed on antigen-activated T cells and can induce and maintain immune tolerance to itself.PD-1 binds to CD274/PDCD1L1 and CD273/PDCD1LG2, transmits inhibitory signals, inhibits T cell activation and regulates immune responses.PD-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
18566 (Gene_ID) Q02242 (L25-Q167) (Accession)
Smiles
LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205290-01	5 µgQM-0205290-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205290-02	10 µgQM-0205290-02 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

50 µgQM-0205290-03	50 µgQM-0205290-03 £137.50/ea	£0.00	Quantity	£137.50/ea	£0.00

100 µgQM-0205290-04	100 µgQM-0205290-04 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

500 µgQM-0205290-05	500 µgQM-0205290-05 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PD-1, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.