Skip to product information
1 of 1

PD-L1, Cynomolgus (HEK293, Fc)

PD-L1, Cynomolgus (HEK293, Fc)

Size

SKU:QM-0181097-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD274 molecule, also known as programmed death ligand 1 (PD-L1), binds to the checkpoint suppressor molecule PD-1 to inhibit TCR-mediated IL-2 production and T cell proliferation signaling. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence. PD-L1 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived PD-L1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    102145573 (Gene_ID) G7PSE7 (F19-T239) (Accession)

  • Smiles

    FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERT

  • Purity

    94.43

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0181097-01
10 µgQM-0181097-01
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0181097-02
50 µgQM-0181097-02
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PD-L1, Cynomolgus (HEK293, Fc)

PD-L1, Cynomolgus (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.