Skip to product information
1 of 1

PD-L2, Mouse (HEK293, His)

PD-L2, Mouse (HEK293, His)

Size

SKU:QM-0169234-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    58205 (Gene_ID) Q9WUL5 (L20-R219) (Accession)

  • Smiles

    LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0169234-01
5 µgQM-0169234-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0169234-02
10 µgQM-0169234-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0169234-03
50 µgQM-0169234-03
£232.25/ea
£0.00
£232.25/ea £0.00
100 µgQM-0169234-04
100 µgQM-0169234-04
£359.82/ea
£0.00
£359.82/ea £0.00
500 µgQM-0169234-05
500 µgQM-0169234-05
£1,040.22/ea
£0.00
£1,040.22/ea £0.00
1 mgQM-0169234-06
1 mgQM-0169234-06
£1,821.47/ea
£0.00
£1,821.47/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PD-L2, Mouse (HEK293, His)

PD-L2, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.