Skip to product information
1 of 1

PD-L2, Rat (HEK293, His)

PD-L2, Rat (HEK293, His)

Size

SKU:QM-0203662-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner, or inhibits T-cell proliferation by blocking cell cycle progression and cytokine production by interacts with PDCD1, and consequently causes cancer growth and suppresses the immune system. PD-L2 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    309304 (Gene_ID) D4AAV6 (L20-R219) (Accession)

  • Smiles

    LFTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVENDTSSQSQRATLLEELLPLGKASFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYVRIDTGILEVPGTGEVQLICQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPNRNFSCMFWNAHMKELTSAIIDPLSWMEPKVPR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203662-01
5 µgQM-0203662-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0203662-02
10 µgQM-0203662-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0203662-03
50 µgQM-0203662-03
£232.25/ea
£0.00
£232.25/ea £0.00
100 µgQM-0203662-04
100 µgQM-0203662-04
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PD-L2, Rat (HEK293, His)

PD-L2, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.