PDCD4, Human (His)

Name: PDCD4, Human (His)
Brand: QuantiMol
SKU: QM-0183272-01
Price: 147.63 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0183272-01

£147.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PDCD4 inhibits translation initiation by disrupting the EIF4A1-EIF4G interaction and inhibiting EIF4A helicase activity. It regulates JUN kinase activation and downregulates MAP4K1, inhibiting invasion and tumorigenesis. PDCD4 Protein, Human (His) is the recombinant human-derived PDCD4 protein, expressed by E. coli , with C-6*His labeled tag.
Molecular Formula
27250 (Gene_ID) Q53EL6 (K212-P357) (Accession)
Smiles
KASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVP
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0183272-01	10 µgQM-0183272-01 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

50 µgQM-0183272-02	50 µgQM-0183272-02 £448.52/ea	£0.00	Quantity	£448.52/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PDCD4, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.