Skip to product information
1 of 1

PDGF-AA, Human

PDGF-AA, Human

Size

SKU:QM-0202629-01

£91.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PDGF-A protein is a key growth factor that regulates embryonic development, cell proliferation, migration, survival, and chemotaxis, and exerts potent mitogenic effects on mesenchymal cells. It is essential for alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, and oligodendrocyte development, and contributes to spinal cord and cerebellar myelination. PDGF-AA Protein, Human is the recombinant human-derived PDGF-AA protein, expressed by E. coli , with tag free.

  • Molecular Formula

    5154 (Gene_ID) P04085-1 (S87-T211) (Accession)

  • Smiles

    SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202629-01
2 µgQM-0202629-01
£91.38/ea
£0.00
£91.38/ea £0.00
10 µgQM-0202629-02
10 µgQM-0202629-02
£238.32/ea
£0.00
£238.32/ea £0.00
50 µgQM-0202629-03
50 µgQM-0202629-03
£614.98/ea
£0.00
£614.98/ea £0.00
100 µgQM-0202629-04
100 µgQM-0202629-04
£990.41/ea
£0.00
£990.41/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PDGF-AA, Human

PDGF-AA, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.