PDGF-AA, Human (His)

Name: PDGF-AA, Human (His)
Brand: QuantiMol
SKU: QM-0205074-01
Price: 68.47 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0205074-01

£68.47 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PDGF-AA Protein, Human (His) is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.
Molecular Formula
5154 (Gene_ID) P04085-1 (S87-T211) (Accession)
Smiles
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Purity
95.1
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205074-01	2 µgQM-0205074-01 £68.47/ea	£0.00	Quantity	£68.47/ea	£0.00

10 µgQM-0205074-02	10 µgQM-0205074-02 £193.37/ea	£0.00	Quantity	£193.37/ea	£0.00

50 µgQM-0205074-03	50 µgQM-0205074-03 £448.52/ea	£0.00	Quantity	£448.52/ea	£0.00

100 µgQM-0205074-04	100 µgQM-0205074-04 £727.97/ea	£0.00	Quantity	£727.97/ea	£0.00

500 µgQM-0205074-05	500 µgQM-0205074-05 £1,599.13/ea	£0.00	Quantity	£1,599.13/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PDGF-AA, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.