PDGF-AA, Mouse

Name: PDGF-AA, Mouse
Brand: QuantiMol
SKU: QM-0202922-01
Price: 76.75 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202922-01

£76.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PDGF-AA Protein, Mouse is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.
Molecular Formula
18590 (Gene_ID) P20033 (S87-T211) (Accession)
Smiles
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202922-01	2 µgQM-0202922-01 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

10 µgQM-0202922-02	10 µgQM-0202922-02 £210.38/ea	£0.00	Quantity	£210.38/ea	£0.00

50 µgQM-0202922-03	50 µgQM-0202922-03 £476.46/ea	£0.00	Quantity	£476.46/ea	£0.00

100 µgQM-0202922-04	100 µgQM-0202922-04 £731.62/ea	£0.00	Quantity	£731.62/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PDGF-AA, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.