Skip to product information
1 of 1

PDGF-BB, Human (His)

PDGF-BB, Human (His)

Size

SKU:QM-0200200-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PDGF-BB protein is a key growth factor that centrally regulates embryonic development, cell proliferation, migration, survival, and chemotaxis. It is known for its potent mitogenic effects on mesenchymal cells and is essential for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in tissues such as the central nervous system, skin, lungs, heart, and placenta. PDGF-BB Protein, Human (His) is the recombinant human-derived PDGF-BB protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    5155 (Gene_ID) P01127-1 (S82-T190) (Accession)

  • Smiles

    SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0200200-01
2 µgQM-0200200-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0200200-02
10 µgQM-0200200-02
£137.50/ea
£0.00
£137.50/ea £0.00
50 µgQM-0200200-03
50 µgQM-0200200-03
£376.83/ea
£0.00
£376.83/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PDGF-BB, Human (His)

PDGF-BB, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.