Skip to product information
1 of 1

PDGF-BB, Mouse (His)

PDGF-BB, Mouse (His)

Size

SKU:QM-0178120-01

£147.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

  • Molecular Formula

    18591 (Gene_ID) AAH53430.1 (S82-T190) (Accession)

  • Smiles

    SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0178120-01
10 µgQM-0178120-01
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0178120-02
50 µgQM-0178120-02
£448.52/ea
£0.00
£448.52/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PDGF-BB, Mouse (His)

PDGF-BB, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.