PDGF-BB, Rat (His)

Name: PDGF-BB, Rat (His)
Brand: QuantiMol
SKU: QM-0201847-01
Price: 91.38 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0201847-01

£91.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.
Molecular Formula
24628 (Gene_ID) Q05028 (S74-T182) (Accession)
Smiles
MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT
Purity
96.2
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0201847-01	2 µgQM-0201847-01 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

10 µgQM-0201847-02	10 µgQM-0201847-02 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

50 µgQM-0201847-03	50 µgQM-0201847-03 £459.45/ea	£0.00	Quantity	£459.45/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PDGF-BB, Rat (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.