Skip to product information
1 of 1

PDGF-CC, Cynomolgus (HEK293, hFc)

PDGF-CC, Cynomolgus (HEK293, hFc)

Size

SKU:QM-0202741-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    / (Gene_ID) EHH54037 (V196-G306) (Accession)

  • Smiles

    VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202741-01
2 µgQM-0202741-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0202741-02
10 µgQM-0202741-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0202741-03
50 µgQM-0202741-03
£299.07/ea
£0.00
£299.07/ea £0.00
100 µgQM-0202741-04
100 µgQM-0202741-04
£470.39/ea
£0.00
£470.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PDGF-CC, Cynomolgus (HEK293, hFc)

PDGF-CC, Cynomolgus (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.